- FAM83H Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-93737
- 0.1 ml
- FAM83H
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- AI3, AI3A
- Human, Rat
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: SDKDKCSAIF RSDSLGTQGR LSRTLPASAE ERDRLLRRME SMRKEKRVYS RFEVFCKKEE ASSPGAGEGP AEEGTRDSKV GKFVPKILGT F
- PBS (pH 7.2) and 40% Glycerol
- family with sequence similarity 83 member H
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
Specifications/Features
Available conjugates: Unconjugated